PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5501_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27680.5 Da    PI: 7.2369
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5501_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.92e-26959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien + rqvtfskRr+g+lKK +ELSvLCda++ +iifsstgkl  y++
  Neem_5501_f_2  9 KRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCT 59
                   79***********************************************96 PP

2K-box50.21.1e-17821651199
          K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                    +   e+l +el  L+ke++ Lq + R++ GedL+s+ +++L  Leq+Le+s++     Knell +q+++l++ke++l+een ++ + ++
  Neem_5501_f_2  82 HDSREQLFNELGVLRKETRRLQLSMRRYTGEDLSSIPYEDLDVLEQELERSVN-----KNELLQQQLDNLRRKERMLEEENSNMYRWIQ 165
                    445678899******************************************96.....9**********************99987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.857161IPR002100Transcription factor, MADS-box
CDDcd002653.83E-40276No hitNo description
SuperFamilySSF554552.49E-29279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-273859IPR002100Transcription factor, MADS-box
PfamPF014863.1E-1681164IPR002487Transcription factor, K-box
PROSITE profilePS5129711.49685170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKIAIKR IENPTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFSS TGKLCQYCTE  60
PYRMEQIIER RLKVTGTRIP EHDSREQLFN ELGVLRKETR RLQLSMRRYT GEDLSSIPYE  120
DLDVLEQELE RSVNKNELLQ QQLDNLRRKE RMLEEENSNM YRWIQEHRAA MEYQQAAMEA  180
KPVEHHQQIL DHFPFCEEQI QTSTVQLQLA TNTIPPQIHP YHLQLAQPNL QDSNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-17285178Myocyte-specific enhancer factor 2A
3kov_B2e-17285178Myocyte-specific enhancer factor 2A
3kov_I2e-17285178Myocyte-specific enhancer factor 2A
3kov_J2e-17285178Myocyte-specific enhancer factor 2A
3p57_A2e-17285178Myocyte-specific enhancer factor 2A
3p57_B2e-17285178Myocyte-specific enhancer factor 2A
3p57_C2e-17285178Myocyte-specific enhancer factor 2A
3p57_D2e-17285178Myocyte-specific enhancer factor 2A
3p57_I2e-17285178Myocyte-specific enhancer factor 2A
3p57_J2e-17285178Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437607.11e-149hypothetical protein CICLE_v10032489mg
SwissprotQ8RYD94e-84TT16_ARATH; Protein TRANSPARENT TESTA 16
TrEMBLV4TC411e-149V4TC41_9R
STRINGVIT_10s0042g00820.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65062543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.26e-77MIKC_MADS family protein